Mouse Myoglobin protein

Artikelnummer: BYT-ORB419335
Artikelname: Mouse Myoglobin protein
Artikelnummer: BYT-ORB419335
Hersteller Artikelnummer: orb419335
Alternativnummer: BYT-ORB419335-20,BYT-ORB419335-100,BYT-ORB419335-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Mb, Myoglobin
This Mouse Myoglobin protein spans the amino acid sequence from region 2-154aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 21.9 kDa
UniProt: P04247
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-taggedExpression Region: 2-154aaSequence Info: Extracellular Domain
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Mb.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Mb.