Human SPI1 protein
Artikelnummer:
BYT-ORB419162
- Bilder (3)
| Artikelname: | Human SPI1 protein |
| Artikelnummer: | BYT-ORB419162 |
| Hersteller Artikelnummer: | orb419162 |
| Alternativnummer: | BYT-ORB419162-20,BYT-ORB419162-100,BYT-ORB419162-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | 31KDA-transforming protein |
| This Human SPI1 protein spans the amino acid sequence from region 1-270aa. Purity: Greater than 85% as determined by SDS-PAGE. |
| Molekulargewicht: | 35.1 kDa |
| UniProt: | P17947 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Homo sapiens (Human) |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGE |
| Anwendungsbeschreibung: | Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 1-270aaSequence Info: Partial |



