Human OXT protein
Artikelnummer:
BYT-ORB419047
- Bilder (3)
| Artikelname: | Human OXT protein |
| Artikelnummer: | BYT-ORB419047 |
| Hersteller Artikelnummer: | orb419047 |
| Alternativnummer: | BYT-ORB419047-20,BYT-ORB419047-100,BYT-ORB419047-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Ocytocin |
| This Human OXT protein spans the amino acid sequence from region 32-125aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 29.6 kDa |
| UniProt: | P01178 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Homo sapiens (Human) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR |
| Anwendungsbeschreibung: | Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 32-125aaSequence Info: Full Length of Mature Protein |



