Bacterial ynaB protein

Artikelnummer: BYT-ORB358826
Artikelname: Bacterial ynaB protein
Artikelnummer: BYT-ORB358826
Hersteller Artikelnummer: orb358826
Alternativnummer: BYT-ORB358826-20,BYT-ORB358826-100,BYT-ORB358826-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: ynaB, BSU17500, Uncharacterized protein YnaB
This Bacterial ynaB protein spans the amino acid sequence from region 1-144aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 32.8 kDa
UniProt: P94480
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Bacillus subtilis (strain 168)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MEDATFHFKDPASPQEISDIEQKLGVTFPNDYKEFLLQHNGMEMFDGIEILSLEGIIEYNEVQDFPEGYVLIGYHFDGRYVIDTNKSKNGLGYMLYLDSIDDIEDAINLDSNFEIWFDMLVSLNGTKYWEVNPNLQEYYKLVSE
Anwendungsbeschreibung: Biological Origin: Bacillus subtilis (strain 168). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.