Mouse Ocm protein

Artikelnummer: BYT-ORB358813
Artikelname: Mouse Ocm protein
Artikelnummer: BYT-ORB358813
Hersteller Artikelnummer: orb358813
Alternativnummer: BYT-ORB358813-20,BYT-ORB358813-100,BYT-ORB358813-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Parvalbumin beta
This Mouse Ocm protein spans the amino acid sequence from region 2-109aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 28.1 kDa
UniProt: P51879
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SITDILSADDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQLKDIFQFIDNDQSGYLDEDELKYFLQRFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.