Plant Omega-5 gliadinImported protein

Artikelnummer: BYT-ORB358810
Artikelname: Plant Omega-5 gliadinImported protein
Artikelnummer: BYT-ORB358810
Hersteller Artikelnummer: orb358810
Alternativnummer: BYT-ORB358810-20,BYT-ORB358810-100,BYT-ORB358810-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: /
This Plant Omega-5 gliadinImported protein spans the amino acid sequence from region 262-439aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 37.5 kDa
UniProt: Q402I5
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Triticum aestivum (Wheat)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: QQQFPQQQSPQQQQFPQQQFPQQQQLPQKQFPQPQQIPQQQQIPQQPQQFPQQQFPQQQQFPQQQEFPQQQFPQQQFHQQQLPQQQFPQQQFPQQQFPQQQQFPQQQQLTQQQFPRPQQSPEQQQFPQQQFPQQPPQQFPQQQFPIPYPPQQSEEPSPYQQYPQQQPSGSDVISISGL
Anwendungsbeschreibung: Biological Origin: Triticum aestivum (Wheat). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.