Bacterial nosZ protein

Artikelnummer: BYT-ORB358807
Artikelname: Bacterial nosZ protein
Artikelnummer: BYT-ORB358807
Hersteller Artikelnummer: orb358807
Alternativnummer: BYT-ORB358807-20,BYT-ORB358807-100,BYT-ORB358807-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: N(2)OR N2O reductase
This Bacterial nosZ protein spans the amino acid sequence from region 58-553aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 71.1 kDa
UniProt: Q51705
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Paracoccus denitrificans
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ASGDGSVAPGQLDDYYGFWSSGQSGEMRILGIPSMRELMRVPVFNRCSATGWGQTNESVRIHERTMSERTKKFLAANGKRIHDNGDLHHVHMSFTEGKYDGRFLFMNDKANTRVARVRCDVMKCDAILEIPNAKGIHGLRPQKWPRSNYVFCNGEDETPLVNDGTNMEDVANYVNVFTAVDADKWEVAWQVLVSGNLDNCDADYEGKWAFSTSYNSEKGMTLPEMTAAEMDHIVVFNIAEIEKAIAAGDYQELNG
Anwendungsbeschreibung: Biological Origin: Paracoccus denitrificans. Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.