Human ERCC5 protein

Artikelnummer: BYT-ORB358806
Artikelname: Human ERCC5 protein
Artikelnummer: BYT-ORB358806
Hersteller Artikelnummer: orb358806
Alternativnummer: BYT-ORB358806-20,BYT-ORB358806-100,BYT-ORB358806-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: DNA excision repair protein ERCC-5 Xeroderma pigmentosum group G-complementing protein
This Human ERCC5 protein spans the amino acid sequence from region 947-1186aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 30.8 kDa
UniProt: P28715
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SFLWGKPDLDKIREFCQRYFGWNRTKTDESLFPVLKQLDAQQTQLRIDSFFRLAQQEKEDAKRIKSQRLNRAVTCMLRKEKEAAASEIEAVSVAMEKEFELLDKAKGKTQKRGITNTLEESSSLKRKRLSDSKGKNTCGGFLGETCLSESSDGSSSEDAESSSLMNVQRRTAAKEPKTSASDSQNSVKEAPVKNGGATTSSSSDSDDDGGKEKMVLVTARSVFGKKRRKLRRARGRKRKT
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: This is his-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.