Viral HBx Peptide X pX protein

Artikelnummer: BYT-ORB358805
Artikelname: Viral HBx Peptide X pX protein
Artikelnummer: BYT-ORB358805
Hersteller Artikelnummer: orb358805
Alternativnummer: BYT-ORB358805-20,BYT-ORB358805-100,BYT-ORB358805-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: HBx Peptide X pX
This Viral HBx Peptide X pX protein spans the amino acid sequence from region 1-154aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 32.6 kDa
UniProt: Q9QMI3
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Hepatitis B virus genotype D subtype ayw (isolate Japan/JYW796/1988) (HBV-D)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKILHKRTLGLSTMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
Anwendungsbeschreibung: Biological Origin: Hepatitis B virus genotype D subtype ayw (isolate Japan/JYW796/1988) (HBV-D). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.