Plant Profilin protein

Artikelnummer: BYT-ORB358801
Artikelname: Plant Profilin protein
Artikelnummer: BYT-ORB358801
Hersteller Artikelnummer: orb358801
Alternativnummer: BYT-ORB358801-20,BYT-ORB358801-100,BYT-ORB358801-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Pollen allergen Mer a 1 Allergen, Mer a 1
This Plant Profilin protein spans the amino acid sequence from region 1-133aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 16.3 kDa
UniProt: O49894
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Annual mercury
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPGHLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIEQGM
Anwendungsbeschreibung: Biological Origin: Annual mercury. Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.