Rabbit CXCL9 protein

Artikelnummer: BYT-ORB358780
Artikelname: Rabbit CXCL9 protein
Artikelnummer: BYT-ORB358780
Hersteller Artikelnummer: orb358780
Alternativnummer: BYT-ORB358780-20,BYT-ORB358780-100,BYT-ORB358780-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: /
This Rabbit CXCL9 protein spans the amino acid sequence from region 23-124aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 27.5 kDa
UniProt: U3KNX2
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Oryctolagus cuniculus (Rabbit)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SPIMRNGRCSCISSTQGKIHLQSLKDLKQFSPSPSCGKTEIIATKKDGTQICLNPDSTEVKELVEKWKKQSSPKKKQKKGKKQRKVKKSLKKSQRPHQKKTA
Anwendungsbeschreibung: Biological Origin: Oryctolagus cuniculus (Rabbit). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.