E. coli lexA protein

Artikelnummer: BYT-ORB358775
Artikelname: E. coli lexA protein
Artikelnummer: BYT-ORB358775
Hersteller Artikelnummer: orb358775
Alternativnummer: BYT-ORB358775-20,BYT-ORB358775-100,BYT-ORB358775-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: lexA, exrA, spr, tsl, umuA, b4043, JW4003LexA repressor, EC 3.4.21.88
This E. coli lexA protein spans the amino acid sequence from region 1-202aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 38.4 kDa
UniProt: P0A7C2
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Escherichia coli (strain K12)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MKALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEEEEGLPLVGRVAAGEPLLAQQHIEGHYQVDPSLFKPNADFLLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVKRLKKQGNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVIRNGDWL
Anwendungsbeschreibung: Biological Origin: Escherichia coli (strain K12). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.