Human FADS2 protein

Artikelnummer: BYT-ORB358772
Artikelname: Human FADS2 protein
Artikelnummer: BYT-ORB358772
Hersteller Artikelnummer: orb358772
Alternativnummer: BYT-ORB358772-20,BYT-ORB358772-100,BYT-ORB358772-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Acyl-CoA 6-desaturase Delta(6) fatty acid desaturase Short name, D6D Short name, Delta(6) desaturase Short name, Delta-6 desaturase
This Human FADS2 protein spans the amino acid sequence from region 1-131aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 30.9 kDa
UniProt: O95864
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATDAFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMNLFKTNHV
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.