Mouse Sap130 protein

Artikelnummer: BYT-ORB358764
Artikelname: Mouse Sap130 protein
Artikelnummer: BYT-ORB358764
Hersteller Artikelnummer: orb358764
Alternativnummer: BYT-ORB358764-20,BYT-ORB358764-100,BYT-ORB358764-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: 130KDA Sin3-associated polypeptide Sin3-associated polypeptide p130
This Mouse Sap130 protein spans the amino acid sequence from region 845-1057aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 26.8 kDa
UniProt: Q8BIH0
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: PRKQQHVISTEEGDMMETNSTDDEKSAAKSLLVKAEKRKSPPKEYIDEEGVRYVPVRPRPPITLLRHYRNPWKAAYHHFQRYSDVRVKEEKKAMLQEIANQKGVSCRAQGWKVHLCAAQLLQLTNLEHDVYERLTNLQEGIIPKKKAATDDDLHRINELIQGNMQRCKLVMDQISEARDSMLKVLDHKDRVLKLLNKNGTVKKVSKLKRKEKV
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.