Human GSK3B protein

Artikelnummer: BYT-ORB358761
Artikelname: Human GSK3B protein
Artikelnummer: BYT-ORB358761
Hersteller Artikelnummer: orb358761
Alternativnummer: BYT-ORB358761-20,BYT-ORB358761-100,BYT-ORB358761-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Serine/threonine-protein kinase GSK3B
This Human GSK3B protein spans the amino acid sequence from region 1-420aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 50.7 kDa
UniProt: P49841
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQP
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.