Bacterial PF0142 protein

Artikelnummer: BYT-ORB358739
Artikelname: Bacterial PF0142 protein
Artikelnummer: BYT-ORB358739
Hersteller Artikelnummer: orb358739
Alternativnummer: BYT-ORB358739-20,BYT-ORB358739-100,BYT-ORB358739-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: L-asparagine amidohydrolase Cleaved into the following 2 chains, Putative L-asparaginase subunit alpha Putative L-asparaginase subunit beta
This Bacterial PF0142 protein spans the amino acid sequence from region 1-175aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 35.5 kDa
UniProt: Q8U4E6
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MVAIIVHGGAGTIRKEERIPKIIEGVREAVLTGWRELKKGSALDAVEEAVKVLEDNPLFNAGTGSVLTLDGKVEMDAAIMRGKTLDAGAVAGIWGVKNPISVARKVMEKTDHVLLIGEGAVKFARLMGFPEYDPTTEERRKQWEELRKKLLETGEIRHWKKLSELIKEYPEVLRS
Anwendungsbeschreibung: Biological Origin: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.