E. coli speB protein

Artikelnummer: BYT-ORB358735
Artikelname: E. coli speB protein
Artikelnummer: BYT-ORB358735
Hersteller Artikelnummer: orb358735
Alternativnummer: BYT-ORB358735-20,BYT-ORB358735-100,BYT-ORB358735-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Agmatine ureohydrolase Short name, AUH
This E. coli speB protein spans the amino acid sequence from region 1-306aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 49.5 kDa
UniProt: B7LFJ6
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Escherichia coli (strain 55989 / EAEC)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSTLGHQYDNSLVSNAFGFLRLPMNFQPYDSDADWVITGVPFDMATSGRAGGRHGPAAIRQVSTNLAWEHNRFPWNFDMRERLNVVDCGDLVYAFGDAREMSEKLQAHAEKLLAAGKRMLSFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTYANGCEFDHGTMFYTAPKEGLIDPNHSVQIGIRTEFDIDNGFTVLDACQVNDRSVDDVIAQVKQIVGDMPVYLTFDIDCLDPAFAPGTGTPVIGGLTSDRA
Anwendungsbeschreibung: Biological Origin: Escherichia coli (strain 55989 / EAEC). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.