Dog CGRP protein

Artikelnummer: BYT-ORB358731
Artikelname: Dog CGRP protein
Artikelnummer: BYT-ORB358731
Hersteller Artikelnummer: orb358731
Alternativnummer: BYT-ORB358731-20,BYT-ORB358731-100,BYT-ORB358731-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Alpha type CGRP protein, Beta type CGRP protein, CALC 1 protein, CALC A protein, CALC1 protein, CALC2 protein, CALCA protein, CALCB protein, Calcitonin 1 protein, Calcitonin 2 protein, CGRP protein, CGRP-I protein, CGRP I protein, CGRP-II protein, CGRP II protein, CGRP 1 protein, CGRP-1 protein, CGRP1 protein, CGRP 2 protein, CGRP-2 protein, CGRP2 protein, Katacalcin protein
This Dog CGRP protein spans the amino acid sequence from region 85-116aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 19.4 kDa
UniProt: P41547
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Canis lupus familiaris (Dog) (Canis familiaris)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: CSNLSTCVLGTYSKDLNNFHTFSGIGFGAETP
Anwendungsbeschreibung: Biological Origin: Canis lupus familiaris (Dog) (Canis familiaris). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.