Mouse Thrsp protein

Artikelnummer: BYT-ORB358726
Artikelname: Mouse Thrsp protein
Artikelnummer: BYT-ORB358726
Hersteller Artikelnummer: orb358726
Alternativnummer: BYT-ORB358726-20,BYT-ORB358726-100,BYT-ORB358726-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Spot 14 protein Short name, S14 Short name, SPOT14
This Mouse Thrsp protein spans the amino acid sequence from region 1-150aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 33.1 kDa
UniProt: Q62264
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MQVLTKRYPKNCLLTVMDRYSAVVRNMEQVVMIPSLLRDVQLSGPGGSVQDGAPDLYTYFTMLKSICVEVDHGLLPREEWQAKVAGNETSEAENDAAETEEAEEDRISEELDLEAQFHLHFCSLHHILTHLTRKAQEVTRKYQEMTGQVL
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.