Mouse Txndc12 protein

Artikelnummer: BYT-ORB358721
Artikelname: Mouse Txndc12 protein
Artikelnummer: BYT-ORB358721
Hersteller Artikelnummer: orb358721
Alternativnummer: BYT-ORB358721-20,BYT-ORB358721-100,BYT-ORB358721-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Endoplasmic reticulum resident protein 19 Short name, ER protein 19 Short name, ERp19 Thioredoxin-like protein p19
This Mouse Txndc12 protein spans the amino acid sequence from region 25-170aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 18.5 kDa
UniProt: Q9CQU0
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: RTGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPRDEDFSPDGGYIPRILFLDPSGKVRPEIINESGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFREKHFQDEL
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.