Human Envelope glycoprotein L protein

Artikelnummer: BYT-ORB358705
Artikelname: Human Envelope glycoprotein L protein
Artikelnummer: BYT-ORB358705
Hersteller Artikelnummer: orb358705
Alternativnummer: BYT-ORB358705-20,BYT-ORB358705-100,BYT-ORB358705-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Glycoprotein 25 Short name, gp25
This Human Envelope glycoprotein L protein spans the amino acid sequence from region 23-137aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 28.7 kDa
UniProt: P03212
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: NWAYPCCHVTQLRAQHLLALENISDIYLVSNQTCDGFSLASLNSPKNGSNQLVISRCANGLNVVSFFISILKRSSSALTGHLRELLTTLETLYGSFSVEDLFGANLNRYAWHRGG
Anwendungsbeschreibung: Biological Origin: Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.