Rat Cyp17a1 protein

Artikelnummer: BYT-ORB358704
Artikelname: Rat Cyp17a1 protein
Artikelnummer: BYT-ORB358704
Hersteller Artikelnummer: orb358704
Alternativnummer: BYT-ORB358704-20,BYT-ORB358704-100,BYT-ORB358704-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: 17-alpha-hydroxyprogesterone aldolase CYPXVII Cytochrome P450 17A1 Cytochrome P450-C17 Short name, Cytochrome P450c17
This Rat Cyp17a1 protein spans the amino acid sequence from region 1-507aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 73.3 kDa
UniProt: P11715
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Rattus norvegicus (Rat)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MWELVGLLLLILAYFFWVKSKTPGAKLPRSLPSLPLVGSLPFLPRRGHMHVNFFKLQEKYGPIYSLRLGTTTTVIIGHYQLAREVLIKKGKEFSGRPQMVTQSLLSDQGKGVAFADAGSSWHLHRKLVFSTFSLFKDGQKLEKLICQEAKSLCDMMLAHDKESIDLSTPIFMSVTNIICAICFNISYEKNDPKLTAIKTFTEGIVDATGDRNLVDIFPWLTIFPNKGLEVIKGYAKVRNEVLTGIFEKCREKFDS
Anwendungsbeschreibung: Biological Origin: Rattus norvegicus (Rat). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.