Viral Nucleoprotein protein

Artikelnummer: BYT-ORB358703
Artikelname: Viral Nucleoprotein protein
Artikelnummer: BYT-ORB358703
Hersteller Artikelnummer: orb358703
Alternativnummer: BYT-ORB358703-20,BYT-ORB358703-100,BYT-ORB358703-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Nucleocapsid protein Protein N
This Viral Nucleoprotein protein spans the amino acid sequence from region 1-564aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 79 kDa
UniProt: P14239
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Junin mammarenavirus (JUNV) (Junn mammarenavirus)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MAHSKEVPSFRWTQSLRRGLSQFTQTVKSDVLKDAKLIADSIDFNQVAQVQRALRKTKRGEEDLNKLRDLNKEVDRLMSMRSVQRNTVFKAGDLGRVERMELASGLGNLKTKFRRAETGSQGVYMGNLSQSQLAKRSEILRTLGFQQQGTGGNGVVRVWDVKDPSKLNNQFGSVPALTIACMTVQGGETMNSVIQALTSLGLLYTVKYPNLSDLDRLTQEHDCLQIVTKDESSINISGYNFSLSAAVKAGASILD
Anwendungsbeschreibung: Biological Origin: Junin mammarenavirus (JUNV) (Junn mammarenavirus). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.