E. coli yihF protein

Artikelnummer: BYT-ORB358701
Artikelname: E. coli yihF protein
Artikelnummer: BYT-ORB358701
Hersteller Artikelnummer: orb358701
Alternativnummer: BYT-ORB358701-20,BYT-ORB358701-100,BYT-ORB358701-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: yihF, b3861, JW5574, Uncharacterized protein YihF
This E. coli yihF protein spans the amino acid sequence from region 25-476aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 66.1 kDa
UniProt: P32128
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Escherichia coli (strain K12)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GTQIQPGVEKFIKDFNDAKKKGEHAYDMTLSYQNFDKGFFNSRFQMQMTFDNGAPDLNIKPGQKVVFDVDVEHGPLPITMLMHGNVIPALAAAKVNLVNNELTQPLFIAAKNKSPVEATLRFAFGGSFSTTLDVAPAEYGKFSFGEGQFTFNGDGSSLSNLDIEGKVEDIVLQLSPMNKVTAKSFTIDSLARLEEKKFPVGESESKFNQINIINHGEDVAQIDAFVAKTRLDRVKDKDYINVNLTYELDKLTKGN
Anwendungsbeschreibung: Biological Origin: Escherichia coli (strain K12). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.