Mouse Lcn3 protein

Artikelnummer: BYT-ORB358697
Artikelname: Mouse Lcn3 protein
Artikelnummer: BYT-ORB358697
Hersteller Artikelnummer: orb358697
Alternativnummer: BYT-ORB358697-20,BYT-ORB358697-100,BYT-ORB358697-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Lipocalin-3 Vomeronasal secretory protein I Short name, VNSP I
This Mouse Lcn3 protein spans the amino acid sequence from region 19-182aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 34.7 kDa
UniProt: Q62471
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: QDSSFLAFNNGNFSGKWFLKALVSEDDIPINKVSPMLILVLNNGDIELSITHMIYDQCLEVTTILEKTDVPGQYLAFEGKTHLQVQLSSVKGHYMLYCDGEIEGMRFLMTQLIGRDPQENLEALEEFKVFTQIKGLVAENLVILEQMEKCEPESFYELPSRPSE
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.