Plant BETVII protein

Artikelnummer: BYT-ORB358690
Artikelname: Plant BETVII protein
Artikelnummer: BYT-ORB358690
Hersteller Artikelnummer: orb358690
Alternativnummer: BYT-ORB358690-20,BYT-ORB358690-100,BYT-ORB358690-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Allergen Bet v II Pollen allergen Bet v 2 Allergen, Bet v 2
This Plant BETVII protein spans the amino acid sequence from region 2-133aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 30.1 kDa
UniProt: P25816
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Betula pendula (European white birch) (Betula verrucosa)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPGHLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIDQGL
Anwendungsbeschreibung: Biological Origin: Betula pendula (European white birch) (Betula verrucosa). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.