Reptile venom metalloproteinase-disintegrin-like mocarhagin protein

Artikelnummer: BYT-ORB358682
Artikelname: Reptile venom metalloproteinase-disintegrin-like mocarhagin protein
Artikelnummer: BYT-ORB358682
Hersteller Artikelnummer: orb358682
Alternativnummer: BYT-ORB358682-20,BYT-ORB358682-100,BYT-ORB358682-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Zinc metalloproteinase mocarhagin
This Reptile venom metalloproteinase-disintegrin-like mocarhagin protein spans the amino acid sequence from region 192-609aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 50.7 kDa
UniProt: Q10749
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Naja mossambica (Mozambique spitting cobra)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: TNTPEQDRYLQAKKYIEFYVVVDNVMYRKYTGKLHVITRRVYEMVNALNTMYRRLNFHIALIGLEIWSNGNEINVQSDVQATLDLFGEWRENKLLPRKRNDNAQLLTSTEFNGTTTGLGYIGSLCSPKKSVAVVQDHSKSTSMVAITMAHQMGHNLGMNDDRASCTCGSNKCIMSTKYYESLSEFSSCSVQEHREYLLRDRPQCILNKPSRKAIVTPPVCGNYFVERGEECDCGSPEDCQNTCCDAATCKLQHEA
Anwendungsbeschreibung: Biological Origin: Naja mossambica (Mozambique spitting cobra). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.