Human SPTAN1 protein

Artikelnummer: BYT-ORB358667
Artikelname: Human SPTAN1 protein
Artikelnummer: BYT-ORB358667
Hersteller Artikelnummer: orb358667
Alternativnummer: BYT-ORB358667-20,BYT-ORB358667-100,BYT-ORB358667-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Alpha-II spectrin Fodrin alpha chain Spectrin, non-erythroid alpha subunit
This Human SPTAN1 protein spans the amino acid sequence from region 1-580aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 83.8 kDa
UniProt: Q13813
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQDLEHVEVLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQDEVNAAWQRLKGLALQRQGKLFGAA
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.