Plant Pla l 1 protein

Artikelnummer: BYT-ORB358665
Artikelname: Plant Pla l 1 protein
Artikelnummer: BYT-ORB358665
Hersteller Artikelnummer: orb358665
Alternativnummer: BYT-ORB358665-20,BYT-ORB358665-100,BYT-ORB358665-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Allergen, Pla l 1
This Plant Pla l 1 protein spans the amino acid sequence from region 1-131aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 30.5 kDa
UniProt: P82242
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Plantago lanceolata (English plantain) (Ribwort plantain)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: TQTSHPAKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKDDSKKVIYSIGGETDQDGVYRLPVVGYHEDCEIKLVKSSRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPLSFRAKTDAPGC
Anwendungsbeschreibung: Biological Origin: Plantago lanceolata (English plantain) (Ribwort plantain). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.