Bacterial albA protein

Artikelnummer: BYT-ORB358662
Artikelname: Bacterial albA protein
Artikelnummer: BYT-ORB358662
Hersteller Artikelnummer: orb358662
Alternativnummer: BYT-ORB358662-20,BYT-ORB358662-100,BYT-ORB358662-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: albA, PF1881DNA/RNA-binding protein Alba
This Bacterial albA protein spans the amino acid sequence from region 1-93aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 26.4 kDa
UniProt: Q8TZV1
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MAEEHVVYIGKKPVMNYVLAVITQFNEGAKEVSIKARGRAISRAVDVAEIVRNRFLKDTVDIKEIKIGTEELPTADGRTTNTSTIEIVLERKV
Anwendungsbeschreibung: Biological Origin: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1). Application Notes: This is His-SUMO-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.