ZEB2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB330041
- Bilder (7)
| Artikelname: | ZEB2 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB330041 |
| Hersteller Artikelnummer: | orb330041 |
| Alternativnummer: | BYT-ORB330041-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human ZEB2 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | anti KIAA0569 antibody, anti SIP-1 antibody, anti SIP1 antibody, anti SMADIP1 antibody, anti ZFHX1B antibody, anti HSPC082 antibody |
| Rabbit polyclonal antibody to ZEB2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 25 kDa |
| NCBI: | 055610 |
| UniProt: | O60315 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: LGRQDGDEEFEEEEEESENKSMDTDPETIRDEEETGDHSMDDSSEDGKME |
| Target-Kategorie: | ZEB2 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 0.4 ug/mL of the antibody was used in this experiment. The protein may be modfied by glycosylation and phosphorylation. |
|
|
Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/mL. |
|
|
Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/mL. |
|
|
Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/mL. |
|
|
IHC Information: Paraffin embedded small intestine, myenteric plexus tissue, tested with an antibody Dilution of 2.5 ug/mL. |
|
|
WB Suggested Anti-ZEB2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Hela cell lysate. |
|
|
ZEB2 antibody - middle region (orb330041) validated by WB using H9 human embryonic stem cells at 1:1000. |
Produktgarantie und fachkundiger Support
