E2f7 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB329925
- Bilder (7)
| Artikelname: | E2f7 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB329925 |
| Hersteller Artikelnummer: | orb329925 |
| Alternativnummer: | BYT-ORB329925-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of mouse E2f7 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | anti A630014C11Rik antibody, anti D10Ertd739e antibody |
| Rabbit polyclonal antibody to E2f7 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 99kDa |
| NCBI: | 848724 |
| UniProt: | Q8BSQ3 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: MEVNCLTLKDLISPRQTRLDFAIEDAENAQKENIFVDRSRMTPKTPMKNE |
| Target-Kategorie: | E2f7 |
|
|
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Note this peptide is 85% identical to the human E2F7 sequence. A 76 kDa isoform also has an 85% match to this sequence. |
|
|
Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/mL. |
|
|
Sample Tissue: Mouse Liver, Antibody Dilution: 1 ug/mL. |
|
|
Sample Tissue: NIH-3T3, Antibody Dilution: 1.0 ug/mL. |
|
|
Sample Type: SP2/0 Whole Cell lysates, Antibody Dilution: 0.05 ug/mL. |
|
|
Mouse stomach |
|
|
WB Suggested Anti-E2f7 Antibody Titration: 0.2-1 ug/mL, Positive Control: SP2/0 cell lysate. |
Produktgarantie und fachkundiger Support
