KMT5B Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324551
Artikelname: KMT5B Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324551
Hersteller Artikelnummer: orb324551
Alternativnummer: BYT-ORB324551-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SUV420H1
Konjugation: Unconjugated
Alternative Synonym: anti CGI-85 antibody, anti CGI85 antibody, anti KMT5B antibody, anti MGC118906 antibody, anti MGC118909 antibody, anti MGC21161 antibody, anti MGC703 antibody
Rabbit polyclonal antibody to SUV420H1
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 99 kDa
UniProt: Q4FZB7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: NNGFNSGSGSSSTKLKIQLKRDEENRGSYTEGLHENGVCCSDPLSLLESR
Target-Kategorie: KMT5B
Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.
Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.
Rabbit Anti-SUV420H1 Antibody, Paraffin Embedded Tissue: Human Skin, Cellular Data: Squamous epithelial cells, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
WB Suggested Anti-SUV420H1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Human Placenta.
WB Suggested Anti-SUV420H1 Antibody, Titration: 1.25 ug/mL, Positive Control: Jurkat Whole Cell.