Rabies virus Glycoprotein
Artikelnummer:
BYT-ORB246532
- Bilder (4)
| Artikelname: | Rabies virus Glycoprotein |
| Artikelnummer: | BYT-ORB246532 |
| Hersteller Artikelnummer: | orb246532 |
| Alternativnummer: | BYT-ORB246532-20,BYT-ORB246532-100,BYT-ORB246532-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Rabies virus Glycoprotein |
| This Rabies virus Glycoprotein spans the amino acid sequence from region 20-459aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 65.5 kDa |
| UniProt: | P03524 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Rabies virus (strain ERA) (RABV) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | KFPIYTILDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYILAIKMNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYRWLRTVKTTKESLVIISPSVADLDPYDRSLHSRVFPSGKCSGVAVSSTYCSTNHDYTIWMPENPRLGMSCDIFTNSRGKRASKGSETCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSNETKWCPPD |
| Anwendungsbeschreibung: | Biological Origin: Rabies virus (strain ERA) (RABV). Application Notes: This is His-SUMO-tag protein |




