Rabies virus Glycoprotein

Artikelnummer: BYT-ORB246532
Artikelname: Rabies virus Glycoprotein
Artikelnummer: BYT-ORB246532
Hersteller Artikelnummer: orb246532
Alternativnummer: BYT-ORB246532-20,BYT-ORB246532-100,BYT-ORB246532-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Rabies virus Glycoprotein
This Rabies virus Glycoprotein spans the amino acid sequence from region 20-459aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 65.5 kDa
UniProt: P03524
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Rabies virus (strain ERA) (RABV)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: KFPIYTILDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYILAIKMNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYRWLRTVKTTKESLVIISPSVADLDPYDRSLHSRVFPSGKCSGVAVSSTYCSTNHDYTIWMPENPRLGMSCDIFTNSRGKRASKGSETCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSNETKWCPPD
Anwendungsbeschreibung: Biological Origin: Rabies virus (strain ERA) (RABV). Application Notes: This is His-SUMO-tag protein
Western blot analysis of Glycoprotein G protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rabies virus (strain ERA) (RABV) G.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Rabies virus (strain ERA) (RABV) G.