Human DLL3 protein

Artikelnummer: BYT-ORB246199
Artikelname: Human DLL3 protein
Artikelnummer: BYT-ORB246199
Hersteller Artikelnummer: orb246199
Alternativnummer: BYT-ORB246199-20,BYT-ORB246199-100,BYT-ORB246199-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: DLL3 protein
This Human DLL3 protein spans the amino acid sequence from region 27-492aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 50.5 kDa
UniProt: Q9NYJ7
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGN
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) DLL3.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) DLL3.
SDS-PAGE analysis of Tris-Glycine gel using Human DLL3 protein