TAF1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer:
BYT-ORB2139997
| Artikelname: |
TAF1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2139997 |
| Hersteller Artikelnummer: |
orb2139997 |
| Alternativnummer: |
BYT-ORB2139997-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
ChIP, IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human TAF1 |
| Konjugation: |
HRP |
| Alternative Synonym: |
OF, XDP, BA2R, CCG1, CCGS, DYT3, KAT4, P250, NSCL2, TAF2A, MRXS33, N-TAF1, TAFII250, DYT3/TAF1, TAFII-250, TAF(II)250 |
| TAF1 Rabbit Polyclonal Antibody (HRP) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
215kDa |
| NCBI: |
620278 |
| UniProt: |
P21675 |
| Puffer: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Formulierung: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Sequenz: |
Synthetic peptide located within the following region: YEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE |
