SRC Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2139990
Artikelname: SRC Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2139990
Hersteller Artikelnummer: orb2139990
Alternativnummer: BYT-ORB2139990-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SRC
Konjugation: HRP
Alternative Synonym: ASV, SRC1, THC6, c-SRC, p60-Src
SRC Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 60kDa
NCBI: 938033
UniProt: P12931
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGP