REST Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2139977
Artikelname: REST Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2139977
Hersteller Artikelnummer: orb2139977
Alternativnummer: BYT-ORB2139977-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human REST
Konjugation: HRP
Alternative Synonym: WT6, XBR, HGF5, NRSF, DFNA27, GINGF5
REST Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 122kDa
NCBI: 005603
UniProt: Q13127
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: PMLPPSAVEEREAVSKTALASPPATMAANESQEIDEDEGIHSHEGSDLSD