MIZF Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2139718
Artikelname: MIZF Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2139718
Hersteller Artikelnummer: orb2139718
Alternativnummer: BYT-ORB2139718-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MIZF
Konjugation: FITC
Alternative Synonym: MIZF, HiNF-P, ZNF743
MIZF Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 60kDa
NCBI: 945322
UniProt: Q9BQA5
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: FKDRSKLREHLRSHTQEKVVACPTCGGMFANNTKFLDHIRRQTSLDQQHF