Recombinant Human C-C chemokine receptor type 6 (CCR6)-VLPs (Active)

Artikelnummer: BYT-ORB1881863
Artikelname: Recombinant Human C-C chemokine receptor type 6 (CCR6)-VLPs (Active)
Artikelnummer: BYT-ORB1881863
Hersteller Artikelnummer: orb1881863
Alternativnummer: BYT-ORB1881863-1,BYT-ORB1881863-100,BYT-ORB1881863-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: CKRL3,CMKBR6,GPR29,STRL22
This Recombinant Human C-C chemokine receptor type 6 (CCR6)-VLPs (Active) spans the sequence from region 1-374aa.
Molekulargewicht: 42.5 kDa
UniProt: P51684
Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4.
Quelle: Homo sapiens (Human)
Formulierung: Lyophilized powder
Sequenz: MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQEVRQFSRLFVPIAYSLICVFGLLGNILVVITFAFYKKARSMTDVYLLNMAIADILFVLTLPFWAVSHATGAWVFSNATCKLLKGIYAINFNCGMLLLTCISMDRYIAIVQATKSFRLRSRTLPRSKIICLVVWGLSVIISSSTFVFNQKYNTQGSDVCEPKYQTVSEPIRWKLLMLGLELLFGFFIPLMFMIFCYTFIVKTLVQAQNSKRHKAIRV
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CCR6 at 10 µg/mL can bind Anti-CCR6 recombinant antibody. The EC50 is 44.79-56.10 ng/mL. The VLPs is negative control. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing
Detected by Mouse anti-6*His monoclonal antibody. The two bands respectively correspond to monomer, Homodimer.
Measured by its binding ability in a functional ELISA. Immobilized Human CCR6 at 10µg/mL can bind Anti-CCR6 recombinant antibody, the EC50 is 44.79-56.10 ng/mL.VLPs is negative control.
The purity of VLPs was greater than 90% as determined by SEC-HPLC