Recombinant Arabidopsis thaliana Plasmodesmata-located protein 7 (PDLP7)

Artikelnummer: BYT-ORB1785462
Artikelname: Recombinant Arabidopsis thaliana Plasmodesmata-located protein 7 (PDLP7)
Artikelnummer: BYT-ORB1785462
Hersteller Artikelnummer: orb1785462
Alternativnummer: BYT-ORB1785462-1,BYT-ORB1785462-100,BYT-ORB1785462-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: (PD-located protein 7)(Cysteine-rich repeat secretory protein 60)
This Recombinant Arabidopsis thaliana Plasmodesmata-located protein 7 (PDLP7) spans the amino acid sequence from region 31-298aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 43.7 kDa
UniProt: Q0WPN8
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Arabidopsis thaliana (Mouse-ear cress)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: TSATDTFVFGGCSQQKFSPASAYESNLNSLLTSLVNSATYSSYNNFTIMGSSSSDTARGLFQCRGDLSMPDCATCVARAVSQVGPLCPFTCGGALQLAGCYIKYDNISFLGQEDKTVVLKKCGSSEGYNTDGISRRDAVLTELVNGGGYFRAGGSGDVQGMGQCVGDLTVSECQDCLGTAIGRLKNDCGTAVFGDMFLAKCYARYSTDGAQHYAKSHNYKTNYGGEKTFAIIIGLLAAVVLLIIFLLFLRGVCSR
Anwendungsbeschreibung: Biological Origin: Arabidopsis thaliana (Mouse-ear cress). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.