Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein Protein
Artikelnummer:
BYT-ORB1476954
- Bilder (1)
| Artikelname: | Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein Protein |
| Artikelnummer: | BYT-ORB1476954 |
| Hersteller Artikelnummer: | orb1476954 |
| Alternativnummer: | BYT-ORB1476954-1,BYT-ORB1476954-100 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | (S glycoprotein)(E2)(Peplomer protein) |
| This Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein Protein spans the amino acid sequence from region 16-685aa(A67V,delta69-70,T95I,G142D,delta143-145,delta211,L212I,ins214-215EPE,G339D,S371L,S373P,S375F,K417N,N440K,G446S,S477N,T478K,E484A,Q493R,G496S,Q498R,N501Y,Y505H,T547K,D614G,H655Y,N679K,P681H). Purity: Greater than 85% as determined by SDS-PAGE. |
| Molekulargewicht: | 81.0 kDa |
| UniProt: | P0DTC2 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHVISGTNGTKRFDNPVLPFNDGVYFASIEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLDHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPIIVREPEDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPR |
| Anwendungsbeschreibung: | Biological Origin: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference |

