Recombinant Rat COMM domain-containing protein 5 (Commd5), Unconjugated, E. coli

Artikelnummer: BIM-RPC26219
Artikelname: Recombinant Rat COMM domain-containing protein 5 (Commd5), Unconjugated, E. coli
Artikelnummer: BIM-RPC26219
Hersteller Artikelnummer: RPC26219
Alternativnummer: BIM-RPC26219-20UG,BIM-RPC26219-100UG,BIM-RPC26219-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Rat
Konjugation: Unconjugated
Alternative Synonym: Hypertension-related calcium-regulated gene protein (HCaRG)
Recombinant Rat COMM domain-containing protein 5 (Commd5) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus). Target Name: Commd5. Target Synonyms: Hypertension-related calcium-regulated gene protein (HCaRG). Accession Number: Q9ERR2. Expression Region: 2~224aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 31.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 31.8kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: SALGAAAPYLHHPADSHSGRVSFLGSQPSPEVTAVAQLLKDLDRSTFRKLLKLVVGALHGKDCREAVEQLGASANLSEERLAVLLAGTHTLLQQALRLPPASLKPDAFQEELQELGIPQDLIGDLASLAFGSQRPLLDSVAQQQGSSLPHVSYFRWRVDVAISTSAQSRSLQPSVLMQLKLTDGSAHRFEVPIAKFQELRYSVALVLKEMAELEKKCERKLQD
Target-Kategorie: Commd5