Recombinant Vaccinia virus DNA topoisomerase 1B (TOP1), Unconjugated, E. coli

Artikelnummer: BIM-RPC26203
Artikelname: Recombinant Vaccinia virus DNA topoisomerase 1B (TOP1), Unconjugated, E. coli
Artikelnummer: BIM-RPC26203
Hersteller Artikelnummer: RPC26203
Alternativnummer: BIM-RPC26203-20UG,BIM-RPC26203-100UG,BIM-RPC26203-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Alternative Synonym: DNA topoisomerase I (Late protein H6, TopIB)
Recombinant Vaccinia virus DNA topoisomerase 1B (TOP1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Vaccinia virus (strain Copenhagen) (VACV). Target Name: TOP1. Target Synonyms: DNA topoisomerase I (Late protein H6, TopIB). Accession Number: P68697. Expression Region: 1~314aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 40.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 40.7kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MRALFYKDGKLFTDNNFLNPVSDDNPAYEVLQHVKIPTHLTDVVVYEQTWEEALTRLIFVGSDSKGRRQYFYGKMHVQNRNAKRDRIFVRVYNVMKRINCFINKNIKKSSTDSNYQLAVFMLMETMFFIRFGKMKYLKENETVGLLTLKNKHIEISPDEIVIKFVGKDKVSHEFVVHKSNRLYKPLLKLTDDSSPEEFLFNKLSERKVYECIKQFGIRIKDLRTYGVNYTFLYNFWTNVKSISPLPSPKKLIALT
Target-Kategorie: TOP1