Recombinant Escherichia phage MS2 Capsid protein, Unconjugated, E. coli

Artikelnummer: BIM-RPC26198
Artikelname: Recombinant Escherichia phage MS2 Capsid protein, Unconjugated, E. coli
Artikelnummer: BIM-RPC26198
Hersteller Artikelnummer: RPC26198
Alternativnummer: BIM-RPC26198-20UG,BIM-RPC26198-100UG,BIM-RPC26198-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Alternative Synonym: Coat protein
Recombinant Escherichia phage MS2 Capsid protein is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Escherichia phage MS2 (Bacteriophage MS2). Target Name: Escherichia phage MS2 Capsid protein. Target Synonyms: Coat protein. Accession Number: P03612. Expression Region: 2~130aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 21.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 21.2kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: ASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQSSAQNRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIY
Target-Kategorie: Escherichia phage MS2 Capsid protein