Recombinant Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin, Unconjugated, E. coli

Artikelnummer: BIM-RPC26132
Artikelname: Recombinant Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin, Unconjugated, E. coli
Artikelnummer: BIM-RPC26132
Hersteller Artikelnummer: RPC26132
Alternativnummer: BIM-RPC26132-20UG,BIM-RPC26132-100UG,BIM-RPC26132-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Plant
Konjugation: Unconjugated
Alternative Synonym: rRNA N-glycosidase (Alpha-TCS)
Recombinant Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Trichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber). Target Name: Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin. Target Synonyms: rRNA N-glycosidase (Alpha-TCS). Accession Number: P09989. Expression Region: 24~270aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 33.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 33.1kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: DVSFRLSGATSSSYGVFISNLRKALPNERKLYDIPLLRSSLPGSQRYALIHLTNYADETISVAIDVTNVYIMGYRAGDTSYFFNEASATEAAKYVFKDAMRKVTLPYSGNYERLQTAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFESPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA
Target-Kategorie: Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin