Recombinant Human Mucin-2 (MUC2), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC26127
Artikelname: Recombinant Human Mucin-2 (MUC2), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC26127
Hersteller Artikelnummer: RPC26127
Alternativnummer: BIM-RPC26127-20UG,BIM-RPC26127-100UG,BIM-RPC26127-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Intestinal mucin-2 (MUC-2, SMUC)
Recombinant Human Mucin-2 (MUC2), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: MUC2. Target Synonyms: Intestinal mucin-2 (MUC-2, SMUC). Accession Number: Q02817. Expression Region: 36~240aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 28.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 28.8kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL
Target-Kategorie: MUC2