Recombinant Saccharomyces cerevisiae 3-methyl-2-oxobutanoate hydroxymethyltransferase (ECM31), Unconjugated, E. coli

Artikelnummer: BIM-RPC26126
Artikelname: Recombinant Saccharomyces cerevisiae 3-methyl-2-oxobutanoate hydroxymethyltransferase (ECM31), Unconjugated, E. coli
Artikelnummer: BIM-RPC26126
Hersteller Artikelnummer: RPC26126
Alternativnummer: BIM-RPC26126-20UG,BIM-RPC26126-100UG,BIM-RPC26126-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Yeast
Konjugation: Unconjugated
Alternative Synonym: Extracellular matrix protein 31 (Ketopantoate hydroxymethyltransferase)
Recombinant Saccharomyces cerevisiae 3-methyl-2-oxobutanoate hydroxymethyltransferase (ECM31) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast). Target Name: ECM31. Target Synonyms: Extracellular matrix protein 31 (Ketopantoate hydroxymethyltransferase). Accession Number: P38122. Expression Region: 1~312aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 38.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 38.5kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MNIMKRQLCTSSKRFFSTAKNVVKYNTIQDIRNKYFTGTPLSMCTAYDFITATWVNKANCDLLLVGDSLAMTSLGYDSTITLSLNEFKYHVASVCRAEGSSMVVVDMPFGTFESGISDGLKNAIDIMKLDSKVTSVKVEVGSYTKDKYAMKFIEELCSRGIPVMAHIGLTPQKVHSLGGYKVQGSKSLLQMQELYETAMQLQKIGCWSILIECVPHKMAQFITSKLSVPTIGIGAGNGTSGQVLVISDLLGMQGD
Target-Kategorie: ECM31