Recombinant Mouse A disintegrin and metalloproteinase with thrombospondin motifs 13 (Adamts13), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC26094
Artikelname: Recombinant Mouse A disintegrin and metalloproteinase with thrombospondin motifs 13 (Adamts13), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC26094
Hersteller Artikelnummer: RPC26094
Alternativnummer: BIM-RPC26094-20UG,BIM-RPC26094-100UG,BIM-RPC26094-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: von Willebrand factor-cleaving protease (vWF-CP, vWF-cleaving protease, ADAM-TS 13, ADAM-TS13, ADAMTS-13, Gm710)
Recombinant Mouse A disintegrin and metalloproteinase with thrombospondin motifs 13 (Adamts13), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Adamts13. Target Synonyms: von Willebrand factor-cleaving protease (vWF-CP, vWF-cleaving protease, ADAM-TS 13, ADAM-TS13, ADAMTS-13, Gm710). Accession Number: Q769J6. Expression Region: 904~1137aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 32.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 32.7kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: WTPLVGLCSISCGRGLKELYFLCMDSVLKMPVQEELCGLASKPPSRWEVCRARPCPARWETQVLAPCPVTCGGGRVPLSVRCVQLDRGHPISVPHSKCSPVPKPGSFEDCSPEPCPARWKVLSLGPCSASCGLGTATQMVACMQLDQGHDNEVNETFCKALVRPQASVPCLIADCAFRWHISAWTECSVSCGDGIQRRHDTCLGPQAQVPVPANFCQHLPKPMTVRGCWAGPCA
Target-Kategorie: Adamts13