Recombinant Vaccinia virus Protein A33 (VACWR156), partial, Unconjugated, Yeast

Artikelnummer: BIM-RPC26081
Artikelname: Recombinant Vaccinia virus Protein A33 (VACWR156), partial, Unconjugated, Yeast
Artikelnummer: BIM-RPC26081
Hersteller Artikelnummer: RPC26081
Alternativnummer: BIM-RPC26081-20UG,BIM-RPC26081-100UG,BIM-RPC26081-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Alternative Synonym: VACWR156, A33RProtein A33
Recombinant Vaccinia virus Protein A33 (VACWR156), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)). Target Name: VACWR156. Target Synonyms: VACWR156, A33RProtein A33. Accession Number: P68617. Expression Region: 57~185aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 16.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 16.2kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: VRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN
Target-Kategorie: VACWR156